180
Views
3
CrossRef citations to date
0
Altmetric
Original Research

Intratumoral Injection of a Human Papillomavirus Therapeutic Vaccine-Induced Strong Anti-TC-1-Grafted Tumor Activity in Mice

, , , & ORCID Icon
Pages 7339-7354 | Published online: 21 Sep 2021

Abstract

Purpose

The route of administration of a therapeutic tumor vaccine is a critical factor in inducing antitumor activity. In this study, we explored the effects of three vaccination routes (subcutaneous, peritumoral, and intratumoral injection) on antitumor activity induced by a human papillomavirus (HPV) therapeutic vaccine containing HPV16 E7 peptide combined with the adjuvant CpG ODN in established TC-1 grafted tumors.

Methods

We used flow cytometry to evaluate splenic and tumor-infiltrating immune cells. We also assessed transcriptional changes in a sequence of immune-related genes in tumors of different treatment groups using quantitative real-time polymerase chain reaction. Immunohistochemistry was used to determine the expression of molecules related to tumor infiltrating immune cells, angiogenesis, and cancer-associated fibroblasts in tumor tissues.

Results

Our results suggested that intratumoral and peritumoral vaccination generated enhanced antitumor activity compared to subcutaneous delivery. In particular, intratumoral vaccination elicited a stronger antitumor effect, with two of the six treated mice being nearly tumor-free at day 28. Three vaccination routes induced increases in splenic CD4+ and/or CD8+ T lymphocytes, and marked decreases in immunosuppressive cells. Peritumoral vaccination increased the tumor-infiltrating CD8+T cells in tumors, while intratumoral vaccination enhanced the tumor-infiltrating CD4+ and CD8+ T lymphocytes, as well as decreased the tumor-infiltrating of immunosuppressive cells, which may result in stronger inhibition of tumor growth and prolonged survival in mice bearing tumors. Furthermore, compared to the subcutaneous route, intratumoral vaccination led to a significant increase in antitumor cytokines and chemokines. In addition, our data showed marked downregulation of MMP-2, MMP-9, VEGF, CD31, and α-SMA in the intratumoral vaccination group, which might contribute to the suppression of tumor invasion, angiogenesis, and metastasis.

Conclusion

Overall, intratumoral vaccination is superior to subcutaneous delivery and has the potential to inhibit tumor growth by improving the tumor microenvironment.

Introduction

Human papillomavirus (HPV) infection is the most common sexually transmitted infection worldwide and persistent infection with high-risk HPV (especially type 16 and 18) can cause cancer of the cervix, vulva, vagina, anus, penis, and oropharynx.Citation1 The enormous global health burden of high-risk HPV persistent infections has promoted extensive prophylactic vaccine development, which have primarily aimed to induce the generation of neutralizing antibodies against the HPV L1 capsid protein.Citation2 Though immune responses induced by the prophylactic vaccines confer protection against infection due to the HPV genotypes included in the vaccines, these prophylactic vaccines have no therapeutic effect on either pre-existing infections or established HPV-associated diseases.Citation3

Cell-mediated immune responses involving T-helper type 1 (Th1) cells and cytotoxic T cells are important for the clearance of established HPV-related diseases. HPV-associated malignancies are driven by HPV oncoproteins E6 and E7, which are required for cellular malignant transformation and are expressed continuously at high levels in transformed cells, and act as tumor-specific antigenic targets.Citation4 An ideal therapeutic vaccine for high-risk HPV-induced cancers could target these oncoproteins to induce robust oncoproteins-specific Th1 and cytotoxic T lymphocyte (CTL) responses that kill HPV-infected and HPV-transformed cells.Citation5 Our prior study found that subcutaneous injection of a vaccine consisting of the HPV16 E7 43–77 peptide, which contains both a CTL epitope (E7 49–57) and two Th epitopes (E7 50–62 and E7 43–77), and the adjuvant, unmethylated cytosine-phosphate-guanosine oligodeoxynucleotide (CpG ODN), induced strong antitumor immune responses and resulted in the eradication of early stage implanted tumors.Citation6,Citation7

A successful cancer therapeutic vaccine should be able to induce a powerful immune response against tumor-specific-antigens to avoid targeting normal host cells and overcome immunosuppression.Citation8 Vaccine immunogenicity may be affected by how the antigens are presented, as well as the vaccine dose, and the administration route of vaccine.Citation9 Conventional vaccines are often administered to the skin or muscle to activate T cells in lymph nodes. Direct intratumoral delivery achieves high local concentration of the vaccine and increases the bioavailability of immunostimulatory products.Citation10 A number of studies have shown that cancer therapeutic vaccines might be more immunogenic when delivered intratumorally.Citation11Citation18 Instead, other studies have suggested that peritumoral injection of vaccines resulted in eradication or strong growth inhibition of established tumors.Citation19,Citation20 In HPV-related skin and mucosal tumors, peritumoral injection and intratumoral injection of vaccines are feasible.Citation21 Building on these observations, we extended our study of vaccines to TC-1-grafted tumors, and compared the antitumor efficacy induced by three different routes (subcutaneous injection, peritumoral injection, and intratumoral injection) of the vaccine. The results showed that intratumoral vaccination was far superior to the subcutaneous route at inducing the inhibition of tumor growth and improvement of the tumor microenvironment (TME), which may provide a significant benefit for the treatment of HPV-associated diseases.

Materials and Methods

Mouse Model and Cell Line

Female C57BL/6 mice (6 to 8 weeks of age) were obtained from the Liaoning Changsheng Biotechnology Co. Ltd. (Benxi, China) and housed in a specific pathogen-free environment. All animal procedures were performed in accordance with the Guidelines for the Care and Use of Laboratory Animals and were approved by the Institutional Animal Care and Use Committee of China Medical University (IACUC Issue No. CMU2019293).

The TC-1 cell line was purchased from Beijing Beina Chuanglian Biotechnology Institute (Beijing, China). TC-1 cells were cultured in Roswell Park Memorial Institute 1640 medium supplemented with G418 (Genview, Tallahassee, FL, USA), 10% heat-inactivated fetal bovine serum, and penicillin-streptomycin (all from Biological Industries, Kibbutz Beit Haemek, Israel).

Peptide and Adjuvant Treatments

The HPV16 E7 peptide (E7 43–77: GQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIR) was provided by GL Biochem (Shanghai) Ltd. (Shanghai, China). The purity of the peptide was verified by high-performance liquid chromatography and was found to be routinely >95%. CpG ODN 1826 (5ʹ-TCCATGACGTTCCTGACGTT-3ʹ) was synthesized by Sangon Biotech (Shanghai) Co. Ltd. (Shanghai, China).

Tumor Treatment and Monitoring

C57BL/6 mice (6 mice per group) were subcutaneously inoculated with 5×105 TC-1 tumor cells at day 0. Tumor-bearing mice were randomly treated with a vaccine containing 20 μg of CpG and 50 μg of E7 peptide in a total volume of 100 μL by subcutaneous injection, peritumoral injection, or intratumoral injection. Tumor volumes were measured using an electronic caliper (Pro’skit, Shanghai, China) and calculation of tumor dimensions were performed using the formula V=0.5×a×b2, where a was the longest superficial diameter and b was the smallest one. To determine the overall survival of the treated tumor-bearing mice, we euthanized mice and counted a death event when the tumor volume of the mouse reached 2000 mm3 or when the tumor diameter was greater than 1.5 cm.

Flow Cytometry

The mice were euthanized, and the spleens and tumors were harvested at day 28. To prepare the splenocyte suspensions, mouse spleens were disrupted and passed through a stainless-steel mesh. Tumor single-cell suspensions were obtained by digesting dissected tumor tissues with 2 mg/mL Collagenase D (Roche, Diagnostics, Indianapolis, IN, USA) and 0.4 mg/mL DNase (Sigma-Aldrich, St. Louis, MO) for 90 minutes at 37°C and subsequently the tumor cells were filtered using a 100 μm strainer.

For surface staining, single-cell suspensions were stained with the following fluorochrome-conjugated monoclonal antibodies: FITC-conjugated anti-mouse CD4 (BD Pharmingen, San Diego, CA, USA), PerCP/Cy5.5-conjugated anti-mouse CD8a (BD Pharmingen, San Diego, CA, USA), PerCP/Cy5.5-conjugated anti-mouse CD11b (eBioscience, San Diego, CA, USA), APC-conjugated anti-mouse CD25 (BD Pharmingen, San Diego, CA, USA), FITC-conjugated anti-mouse Gr-1 (eBioscience, San Diego, CA, USA), and PE-conjugated anti-mouse F4/80 (eBioscience, San Diego, CA, USA).

For intracellular interferon gamma (IFN-γ) staining, cells were incubated with 1 μg/mL Phorbol 12-myristate 13-acetate and 50 μg/mL Ionomycin (all from Sigma-Aldrich, St. Louis, MO, USA). After the 1-hour incubation, GolgiPlug (BD Biosciences, San Diego, CA, USA) was added for 4 hours to inhibit protein secretion. Intracellular CD206 and IFN-γ staining was performed using the Cytofix/Cytoperm kit (BD Biosciences, San Diego, CA, USA) according to the manufacturer’s instructions. Following the fixation/permeabilization, cells were additionally stained with APC-conjugated anti-mouse CD206 (eBioscience, San Diego, CA, USA), PE-conjugated anti-mouse IFN-γ (BD Pharmingen, San Diego, CA, USA) or isotype controls.

For intranuclear staining of Foxp3, cells were fixed and permeabilized using the Foxp3/Transcription Factor Staining Buffer Set (Invitrogen, Carlsbad, CA, USA). Following the fixation and permeabilization, cells were stained with PE-conjugated anti-mouse Foxp3 (eBioscience, San Diego, CA, USA). Analysis was performed using a BD LSRFortessa flow cytometer (BD Biosciences, USA) and FlowJo software (TreeStar, Ashland, OR, USA).

Immunohistochemistry

Immunohistochemical staining was performed on formalin-fixed and paraffin-embedded tissue. Heat-induced antigen retrieval was performed with EDTA buffer at pH=9.0. Sections (3-μm thick) were treated with the following primary antibodies: CD4, CD8, CD31, and alpha-smooth muscle actin (α-SMA) (rabbit polyclonal antibodies, ABclonal Biotech Co, Ltd, Wuhan, China, 1:200 dilution) and incubated overnight at 4°C. After overnight incubation, the slides were treated with biotinylated secondary antibodies and streptavidin-horseradish peroxidase (Maixin Biotechnology, Fuzhou, Fujian, China). The final stain was developed using 3,3ʹ-diaminobenzidine tetrahydrochloride (Maixin Biotechnology, Fuzhou, Fujian, China) as the chromogen. The stained sections were counterstained with hematoxylin and coverslipped.

Staining intensity was scored on a four-point scale: negative (no stain, 0), weak (1), moderate (2), and strong (3). The extent of staining (percentage of positive tumor cells) was scored as follows: 0 (0%), 1 (1%–10%), 2 (11%–50%), 3 (51%–80%), and 4 (>80%). The intensity scores and extent of staining were multiplied to give a composite score ranging from 1 to 12 for each tumor.

RNA Extraction and Quantitative Real-Time Reverse Transcription Polymerase Chain Reaction

Total RNA was extracted from whole tumors using TRIzol Reagent (Invitrogen, Carlsbad, CA, USA) according to the manufacturer’s instructions. The extracted RNA was reverse transcribed using a Reverse Transcription System (Promega, Madison, WI, USA) for cDNA synthesis. PCR analysis was performed using the SYBR qPCR Master Mix (Vazyme, Nanjing, China). Specific primers used for the quantitative real-time reverse transcription polymerase chain reaction (qRT-PCR) experiments are listed in . β-actin was used as the endogenous control. The 2−ΔΔCt method was used to calculate the relative quantity of gene expression.

Table 1 qRT-PCR Primers Used in the Study

Statistical Analysis

All statistical analyses were performed using GraphPad Prism software version 5.0 (GraphPad Software Inc., San Diego, CA, USA). Survival analysis curves were created using Kaplan-Meier methods and compared by the Log rank test. The rest of data were analyzed using one-way analysis of variance (ANOVA) followed by Tukey’s multiple comparison test. Differences were considered significant at a p-value < 0.05. The data are presented as the mean±standard deviation (SD). P-values were as follows: *p<0.05, **p<0.01, and ***p<0.001.

Results

Peritumoral or Intratumoral Injection of Vaccine Induced Inhibition of Established Tumors

To investigate a potential antitumor effect of different administration routes of vaccine, TC-1 tumor cells were injected subcutaneously in the right flank of mice on day 0. When the tumor volume reached 150±50 mm3, mice were treated with vaccine containing 20 μg of CpG and 50 μg of E7 peptide on days 9, 16, and 23 by subcutaneous injection, peritumoral injection or intratumoral injection (). Mice with TC-1 grafted tumors showed variation in the response to different administration routes of the vaccine. Tumors maintained sustained development in all mice in the control group. The majority of tumors in mice receiving subcutaneously injected vaccine grew slower than untreated mice. All mice treated with peritumoral or intratumoral injection of the vaccine responded almost completely or partially reduction in tumor volume (). The peritumoral or intratumoral injection of the vaccine significantly inhibited tumor growth, as indicated by 60.86% (p<0.001) and 67.10% (p<0.001) reductions, respectively, in mean tumor volume compared to that of control mice, as well as 53.85% (p<0.01) and 61.21% (p<0.001), respective reductions relative to subcutaneous injected mice (). At the endpoint of the experiment, tumors were excised from the mice and weighed (). The peritumoral (1.64±0.63 g) or intratumoral (1.49±1.25 g) injection of the vaccine resulted in significantly decreased in tumor weight compared to the control group (4.43±2.14 g, p<0.01), and the subcutaneous injected group (3.77±0.56 g, p<0.05) (). presents the survival curves of mice treated with different administration routes of the vaccine. The first mice were found dead on day 14 after TC-1 cells were inoculated in the control group (). In vaccinated mice, a significant delay in time to death was registered. At 50 days after the inoculation of TC-1 cells, the percentage of mice that survived in the subcutaneous and peritumoral injected group was 33.33% and 50%, respectively (). The percentage of animals that survived was 83.33% in the intratumoral injected group at the endpoint of the experiment (). In short, these data indicated that the peritumoral and intratumoral treatment showed significantly improved antitumor efficacy on the inhibition of tumor growth and prolonged mouse survival compared with the control group. Although there was no statistical difference between the peritumoral injection group and the intratumoral injection group, intratumoral vaccination achieved better effects on the inhibition of tumor growth and two of the six mice were nearly tumor-free at day 28.

Figure 1 Effects of three different administration routes of vaccine on the inhibition of tumor growth. (A) Treatment schedule: All the mice were injected subcutaneously into the right flank with a single-cell suspension of 5×105 TC-1 cells for tumor formation at day 0. After tumor cell inoculation, tumor-bearing mice were treated with the vaccine by subcutaneous injection, peritumoral injection or intratumoral injection at days 9, 16, and 23. (B) Tumor volumes in the four groups were assessed over time. (C) Graphical representation of tumor volumes at day 28. (D) Photography of tumors excised from the mice at the endpoint of the experiment. From top to bottom, PBS-treated group, subcutaneous injection group, peritumoral injection group, and intratumoral injection group. (E) Tumor weights (grams) at the time of excision. (F) Kaplan-Meier survival curves of different groups of tumor-bearing mice. The experiments were repeated twice and one of the two experiment results was presented. The data are expressed as the mean±SD (n=6). The significance of the tumor volumes and the tumor weights was evaluated by one-way ANOVA followed by Tukey’s multiple comparison test. Overall survival was estimated according to Kaplan-Meier methods and was compared using the Log rank test (*p<0.05, **p<0.01, ***p<0.001).

Figure 1 Effects of three different administration routes of vaccine on the inhibition of tumor growth. (A) Treatment schedule: All the mice were injected subcutaneously into the right flank with a single-cell suspension of 5×105 TC-1 cells for tumor formation at day 0. After tumor cell inoculation, tumor-bearing mice were treated with the vaccine by subcutaneous injection, peritumoral injection or intratumoral injection at days 9, 16, and 23. (B) Tumor volumes in the four groups were assessed over time. (C) Graphical representation of tumor volumes at day 28. (D) Photography of tumors excised from the mice at the endpoint of the experiment. From top to bottom, PBS-treated group, subcutaneous injection group, peritumoral injection group, and intratumoral injection group. (E) Tumor weights (grams) at the time of excision. (F) Kaplan-Meier survival curves of different groups of tumor-bearing mice. The experiments were repeated twice and one of the two experiment results was presented. The data are expressed as the mean±SD (n=6). The significance of the tumor volumes and the tumor weights was evaluated by one-way ANOVA followed by Tukey’s multiple comparison test. Overall survival was estimated according to Kaplan-Meier methods and was compared using the Log rank test (*p<0.05, **p<0.01, ***p<0.001).

Effects of Different Administration Routes of the Vaccine on Systemic Immune Responses

To evaluate the effects of three different administration routes of the vaccine on the systemic immune responses, mouse spleens were harvested and dissociated to assess the proportion of immune cells by flow cytometry analysis. The proportion of CD4+ cells among total splenocytes was significantly increased from 8.03% in the control group to 12.38% (p<0.001) in the subcutaneous injection group and 11.92% (p<0.01) in the intratumoral injection group (). The three different administration routes of the vaccine significantly improved the percentage of splenic CD8+ T cells (; control group: 3.67%±3.12%; subcutaneous group: 9.09%±2.04%, p<0.001; peritumoral group: 8.55%±0.68%, p<0.01; and intratumoral group: 8.16%±0.61%, p<0.01). The subcutaneous and intratumoral injection of the vaccine further enhanced IFN-γ expression by 1.5-fold (p<0.05) and 2-fold (p<0.01) compared with that in the PBS control group (), respectively. Although there were significant differences in the percentage of IFN-γ-secreting cells between the four groups, the IFN-γ-secreting cell counts were low which might be attributed to the presence of dead cells in the analyzed cells. We next evaluated the impact of different administration routes of the vaccine on splenic immunosuppression. We found that subcutaneous (p<0.05) and intratumoral (p<0.01) treatment significantly decreased the proportion of splenic myeloid-derived suppressor cells (MDSCs) compared with the control group (). Furthermore, the data indicated that the three vaccination routes significantly reduced the percentage of splenic regulatory T cells (Tregs) and type 2-polarized tumor-associated macrophages (M2-TAMs). We observed a decreased fraction of CD25+Foxp3+ T cells within CD4+ cells in the subcutaneous (15.90%±1.24%, p<0.05), peritumoral (14.57%±1.18%, p<0.001), and intratumoral treatment group (13.90%±0.73%, p<0.001) relative to the control group (17.93%±1.44%) (). The subcutaneous, peritumoral and intratumoral injection of the vaccine led to a decrease in F4/80+CD206+ cells among the CD11b+ cell population, resulting in a 32.83%, 44.91%, and 63.65% decrease of M2-TAMs than that of control group, respectively ().

Figure 2 Effects of three different administration routes of the vaccine on the systemic immune responses. Representative cytometric dot plots of (A) CD4, (C) CD8, (E) IFN-γ, (G) MDSCs, (I) Tregs, and (K) M2-TAMs. Flow cytometry data showing splenic CD4, CD8, and IFN-γ positive cells represented as a bar graph expressed as (B) percentage of CD4+ T cells; (D) percentage of CD8+, and (F) percentage of IFN-γ cells. (H) The frequency of splenic MDSCs expressed as the percentage of CD11b and Gr-1 double positive cells. (J) The percentage of splenic Tregs represented as the frequency of CD25 and Foxp3 double-positive cells among CD4+ T cells. (L) The fraction of M2-TAMs expressed as the frequency of F4/80 and CD206 double-positive cells within CD11b+ splenocytes. The data are expressed as the mean±SD (n=3). The significance of the data was evaluated by one-way ANOVA followed by Tukey’s multiple comparison test (*p<0.05, **p<0.01, ***p<0.001).

Figure 2 Effects of three different administration routes of the vaccine on the systemic immune responses. Representative cytometric dot plots of (A) CD4, (C) CD8, (E) IFN-γ, (G) MDSCs, (I) Tregs, and (K) M2-TAMs. Flow cytometry data showing splenic CD4, CD8, and IFN-γ positive cells represented as a bar graph expressed as (B) percentage of CD4+ T cells; (D) percentage of CD8+, and (F) percentage of IFN-γ cells. (H) The frequency of splenic MDSCs expressed as the percentage of CD11b and Gr-1 double positive cells. (J) The percentage of splenic Tregs represented as the frequency of CD25 and Foxp3 double-positive cells among CD4+ T cells. (L) The fraction of M2-TAMs expressed as the frequency of F4/80 and CD206 double-positive cells within CD11b+ splenocytes. The data are expressed as the mean±SD (n=3). The significance of the data was evaluated by one-way ANOVA followed by Tukey’s multiple comparison test (*p<0.05, **p<0.01, ***p<0.001).

Effects of Different Administration Routes of the Vaccine on Tumor-Infiltrating Lymphocytes

To characterize the effects of the different administration routes of vaccine on the tumor-infiltrating lymphocytes (TILs), tumors were harvested 5 days after last treatment and analyzed by flow cytometry to allow a clear comparison of relative numbers of immune cells among treatment groups. The intratumoral injection of the vaccine increased the proportion of CD4+ T cells within the TILs (11.49%±2.58%) compared with the control group (7.59%±1.38%, p<0.05) and the subcutaneous injection group (7.79%±2.47%, p<0.05) (). The peritumoral injection and intratumoral injection of the vaccine led to a significant increase in the density of CD8+ T cells, from 4.01% in the control group to 6.61% (p<0.05) in the peritumoral injection group and 7.57% (p<0.05) in the intratumoral injection group (). The expression of IFN-γ increased in all three treatment groups relative to the control group, albeit the differences were not significant (). In addition, the intratumoral injection of the vaccine significantly reduced the percentage of MDSCs (CD11b+Gr-1+) from 11.39% in the control group to 6.76% (p<0.05) (). We observed a decreased fraction of CD25+Foxp3+ T cells among CD4+ cells in the intratumoral treatment group (15.10%±3.95%) relative to the control group (23.33%±1.26%, p<0.05) and the subcutaneous injection group (22.97%±4.76%, p<0.05) (). The intratumoral injection of the vaccine led to a decrease in F4/80+CD206+ cells within the CD11b+ cell population, resulting in a 33.49%, 30.31%, and 27.03% decrease of M2-TAMs compared to the control group, subcutaneous, and peritumoral treatment group, respectively (). These results indicated that the intratumoral injection of the vaccine might promote the recruitment and activation of CD4+ and CD8+ T cells, reducing immunosuppressive cells including Tregs, MDSCs, and M2-TAMs, demonstrating a reversal of the immunosuppressive phenotype of the TILs.

Figure 3 Effects of three different administration routes of the vaccine on TILs. The number of TILs was determined on day 28 by FACS. Representative flow cytometry results from one mouse of three mice showing tumor-infiltrating (A) CD4, (C) CD8, (E) IFN-γ, (G) MDSCs, (I) Tregs, and (K) M2-TAMs. Flow cytometry data showing intratumoral CD4, CD8 and IFN-γ positive cells as represented as a bar graph expressed as (B) percentage of CD4+ T cells; (D) percentage of CD8+, and (F) percentage of IFN-γ cells. (H) The frequency of tumor infiltrating MDSCs expressed as the percentage of CD11b and Gr-1 double-positive cells. (J) The percentage of intratumoral Tregs represented as the frequency of CD25 and Foxp3 double-positive cells among CD4+ T cells. (L) The fraction of M2-TAMs was expressed as the frequency of F4/80 and CD206 double positive cells within CD11b+ tumor infiltrating cells. The data are expressed as the mean±SD (n=3). The significance of the data was evaluated by one-way ANOVA followed by Tukey’s multiple comparison test (*p<0.05, **p<0.01, ***p<0.001).

Figure 3 Effects of three different administration routes of the vaccine on TILs. The number of TILs was determined on day 28 by FACS. Representative flow cytometry results from one mouse of three mice showing tumor-infiltrating (A) CD4, (C) CD8, (E) IFN-γ, (G) MDSCs, (I) Tregs, and (K) M2-TAMs. Flow cytometry data showing intratumoral CD4, CD8 and IFN-γ positive cells as represented as a bar graph expressed as (B) percentage of CD4+ T cells; (D) percentage of CD8+, and (F) percentage of IFN-γ cells. (H) The frequency of tumor infiltrating MDSCs expressed as the percentage of CD11b and Gr-1 double-positive cells. (J) The percentage of intratumoral Tregs represented as the frequency of CD25 and Foxp3 double-positive cells among CD4+ T cells. (L) The fraction of M2-TAMs was expressed as the frequency of F4/80 and CD206 double positive cells within CD11b+ tumor infiltrating cells. The data are expressed as the mean±SD (n=3). The significance of the data was evaluated by one-way ANOVA followed by Tukey’s multiple comparison test (*p<0.05, **p<0.01, ***p<0.001).

Effects of Different Administration Routes of the Vaccine on Cytokines, Chemokines, and Matrix Metalloproteinases (MMPs) in the Tumor

The level of transcripts of interleukin (IL)-2, IL-12, tumor necrosis factor alpha (TNF-α), IFN-γ were significantly increased by 5-fold (p<0.001) (), 3-fold (p<0.001) (), 2-fold (p<0.001) (), and 18-fold (p<0.001) (), respectively, compared to those in the control group. The mRNA level of IL-10, transforming growth factor beta (TGF-β), CXC-chemokine ligand (CXCL) 1, and vascular endothelial growth factor (VEGF) in the intratumoral group was significantly reduced by 47.60% (p<0.01) (), 86.59% (p<0.001) (), 96.26% (p<0.01) () and 92.14% (p<0.001) (), respectively, compared to that in the control group. CXCL9 and CXCL10 mRNA expression levels in the tumor tissue of intratumoral injected mice were increased by 2-fold (p<0.001) () and 1-fold (p<0.05) (), respectively, compared to those of control mice. In addition to cytokines and chemokines, we also determined the expression levels of MMPs. The relative mRNA levels of MMP-2 and MMP-9 in the tumor tissue of intratumoral vaccinated mice were reduced by 96.24% (p<0.05) () and 94.68% (p<0.05) (), respectively, compared to those of control mice. Furthermore, the subcutaneous injection of the vaccine resulted in a significant increase in the relative expression of intratumoral TNF-α (p<0.05) (), CXCL9 (p<0.01) (), and CXCL10 (p<0.05) () and significantly decreased expression of intratumoral IL-10 (p<0.05) (), TGF-β (p<0.001) (), and CXCL1 (p<0.01) () compared to that of control mice. Likewise, the relative expression of TGF-β (p<0.001) (), CXCL1 (p<0.01) (), MMP-2 (p<0.05) (), MMP-9 (p<0.05) (), and VEGF (p<0.001) () in peritumoral vaccination mice significantly decreased compared to that of the control group. In addition, the peritumoral injection of the vaccine significantly increased the level of intratumoral TNF-α (p<0.001) () and CXCL9 (p<0.01) ().

Figure 4 The relative mRNA expression of cytokines, chemokines and MMPs. The relative mRNA expression levels of (A) IL-2, (B) IL-10, (C) IL-12, (D) TNF-α, (E) TGF-β, (F) IFN-γ, (G) CXCL1, (H) CXCL9, (I) CXCL10, (J) MMP-2, (K) MMP-9, and (L) VEGF in the tumor tissue are shown. All PCR data were calculated relative to β-actin and represent the average±SD of triplicate samples. The significance of the data was evaluated by one-way ANOVA followed by Tukey’s multiple comparison test (*p<0.05, **p<0.01, ***p<0.001).

Figure 4 The relative mRNA expression of cytokines, chemokines and MMPs. The relative mRNA expression levels of (A) IL-2, (B) IL-10, (C) IL-12, (D) TNF-α, (E) TGF-β, (F) IFN-γ, (G) CXCL1, (H) CXCL9, (I) CXCL10, (J) MMP-2, (K) MMP-9, and (L) VEGF in the tumor tissue are shown. All PCR data were calculated relative to β-actin and represent the average±SD of triplicate samples. The significance of the data was evaluated by one-way ANOVA followed by Tukey’s multiple comparison test (*p<0.05, **p<0.01, ***p<0.001).

Effects of Different Administration Routes of the Vaccine on CD4, CD8, CD31, and α-SMA Expression

The representative immunohistochemical staining in indicated the expression of CD4+ and CD8+ cells in tumor tissue. The tumor infiltrated CD4+ and CD8+ T lymphocytes were distributed around both the tumor tissue and the blood vessels. The peritumoral injection and intratumoral injection of the vaccine significantly increased the density of CD4+ and CD8+ T cells relative to the control group (). The intratumoral microvessel density (MVD) was quantified by measuring CD31-positive staining which was mainly detected in the vascular endothelial cell membrane. The IHC images suggested that neoplastic endothelial cells forming the vascular structure were positive and other regions of the tumor showed low expression of CD31 (). All capillaries expressing membranous CD31 were counted at 400× magnification. We found a significantly less MVD in the intratumoral group (1.91±0.30) than in the control group (3.09±0.83) and the subcutaneous group (2.91±1.30) (), which suggested that the intratumoral injection of the vaccine significantly reduced the MVD in the tumors. α-SMA positive staining was mainly detected in the tumor stroma, the IHC staining results indicated that α-SMA expression in the intratumoral injection group was significantly lower than that in the control group ().

Figure 5 The abundance of CD4, CD8, CD31, and α-SMA expression by immunohistochemistry analysis. Representative images of (A) CD4, (B) CD8, (C) CD31, and (D) α-SMA staining are shown. Immunohistochemistry score of (E) CD4, (F) CD8, and (H) α-SMA. (G) Intratumoral MVD was quantified by measuring CD31-positive staining. The scale bar is located in the upper left corner of the immunohistochemistry image. Images are shown at 100× magnification and scale bars = 100 μm. The insert images are at 400× magnification and scale bars = 50 μm. The data are expressed as the mean±SD. The significance of the data was evaluated by one-way ANOVA followed by Tukey’s multiple comparison test (*p<0.05, **p<0.01, ***p<0.001).

Figure 5 The abundance of CD4, CD8, CD31, and α-SMA expression by immunohistochemistry analysis. Representative images of (A) CD4, (B) CD8, (C) CD31, and (D) α-SMA staining are shown. Immunohistochemistry score of (E) CD4, (F) CD8, and (H) α-SMA. (G) Intratumoral MVD was quantified by measuring CD31-positive staining. The scale bar is located in the upper left corner of the immunohistochemistry image. Images are shown at 100× magnification and scale bars = 100 μm. The insert images are at 400× magnification and scale bars = 50 μm. The data are expressed as the mean±SD. The significance of the data was evaluated by one-way ANOVA followed by Tukey’s multiple comparison test (*p<0.05, **p<0.01, ***p<0.001).

Discussion

In this study, we explored the effects of three routes of vaccination on the inhibition of TC-1 grafted tumors. We found that intratumoral and peritumoral vaccination reversed tumor growth when compared to subcutaneously vaccination or compared to control treatment (). Considering the results of our previous studies in which the antitumor effect of subcutaneous vaccination was demonstrated for early-stage tumors,Citation6,Citation7 we speculated that subcutaneous injection may be more effective for early-stage tumors. For late-stage tumors, subcutaneous inoculation might not significantly attenuate the growth rate of tumors (). Although peritumoral injection inhibited tumor growth, the intratumoral injection of the vaccine elicited a stronger antitumor effect, with two of the six mice becoming nearly tumor-free at day 28 (). Furthermore, the antitumor effect translated into improved survival in the intratumoral injected mice (p<0.01) as compared to the untreated mice (). In short, we observed significant tumor regression and survival improvement when the vaccine was delivered directly into the tumor tissue as compared to either untreated or subcutaneous injection of the vaccine.

Ishida et alCitation16 and Peng et alCitation17 recently demonstrated superior effects of intratumoral delivery of HPV16 E7 peptide-based vaccines using TC-1 tumor model in C57BL/6 mice; however, there are several differences between these studies and the present study. First, the formulation of the vaccine in our study and in the two similar studies differed. The vaccine used in the study by Ishida et alCitation16 was a HPV 16 E7 49–57 short peptide, which contained only a single CD8 epitope, and Peng et alCitation17 used two short peptides as antigens, which were HPV 16 E7 49–57 peptide containing a CD8 epitope and the HPV 16 E7 43–62 peptide containing a CD4 epitope. In our current study, we used the HPV 16 E7 43–77 long peptide vaccine, which not only contains a CD8 epitope, but also contains two CD4 epitopes. CD4 cells play a vital role in the anti-tumor immune response. Activated Th1 CD4 cells are capable of producing IFN-γ which mediates the enhancement of MHC expression on tumor cells, the recognition and eradication of tumor cells by T cells.Citation22 Furthermore, CD4 T cells are required for infiltration of CD8 T cells to the tumor site,Citation23Citation25 which is critical for the efficacy of immunotherapy and for long-term antitumor effects. In addition, the adjuvant used in Ishida et al’s study was the TLR3 agonist poly (I:C), while the adjuvant used in our study was the TLR9 agonist CpG ODN. We believe that the efficient inoculation route for vaccines with different formulations may differ. Differences in adjuvants will also have an impact on the anti-tumor effects of therapeutic vaccines. It is worth investigating effective inoculation routes for given vaccine formulations. Moreover, Ishida et alCitation16 administered the vaccine when the tumor xenograft volume in mice was about 50 mm3, while the vaccine intervention was also performed during the early stage of tumor formation (at days 3, 6, and 10) in the study by Peng et al.Citation17 Our previous research results demonstrated that the HPV E7 43–77 long peptide vaccine with CpG ODN as an adjuvant in the early stage of tumor formation in mice (Day 4, tumor volume was approximately 50 mm3) showed excellent tumor inhibition effects. Tumor dimensions of mice were significantly reduced, and some tumors even disappeared.Citation6 But as the results of our current study have shown, when the tumor volume in mice reached a certain level (eg, 150±50 mm3), the subcutaneous administrated vaccines cannot completely control tumor growth, which may be due to the potential presence of an immunosuppressive TME. Thus, we evaluated the intratumoral or peritumoral routes of vaccination, and evaluated the impact of different vaccination routes on the TME. Last but not least, cervical cancer has an insidious onset, and most cervical cancer patients found in the clinic are middle to late stage patients in low- and middle-income countries.Citation26,Citation27 We believe that exploring the therapeutic effect of vaccines on larger or advanced tumors has greater clinical value.

Therapeutic cancer vaccines aim to promote immune responses, and in particular, activate cytotoxic CD8+ T cells that are specific to tumor antigens.Citation28 In order to better understand the mechanisms underlying differences in antitumor effects, we examined the effects of the different administration routes of the vaccine on systemic and tumor local immune responses. We found that subcutaneous injection of the vaccine induced stronger systemic immune responses, but the local immune responses were weaker than that of intratumoral and peritumoral vaccine routes, which further demonstrated that the local immune response played a major role in the antitumor effect. Subcutaneous injections activate dermal dendritic cells and Langerhans cells, promoting an effective antigen processing and eventually effectively stimulating cellular immune response and humoral immune responses,Citation29,Citation30 which might explain why subcutaneous vaccination induced the significant systemic immune response. Instead, the intratumoral injection of the vaccine enhanced the locoregional antitumor efficacy by enabling high bioavailability of vaccines directly at the injected tumor sites and reduced systemic toxicity.Citation31 In addition, the flow cytometry results of tumor cells showed that only CD8+ T cells in the peritumoral injection group increased significantly, but the antitumor effect of the peritumoral group was adequate. We hypothesized that the presence of CD8+ T cells in the TME are crucial to the rejection of the tumor induced by the vaccine. However, we have not performed knockout studies to verify these hypotheses at present, but this will be addressed in future studies. Essentially, our results suggested that intratumoral injection of the vaccine triggered not only local immunologic responses but also systemic immunologic responses, both of which contributed to an improved antitumor response.

The bottleneck for cancer immunotherapy is the immunosuppressive TME in which the tumor cells are located.Citation32 MDSCs, Tregs, M2-TAMs, and inhibitory cytokines are the major components of the immune system that cause the subversion of antitumor immunity in the TME.Citation32 MDSCs elicit immunosuppression systemically and locally in the TME through different pathways, including promoting cancer cell proliferation and survival, angiogenesis and lymph angiogenesis, and the expression of immunosuppressive cytokines.Citation33 Tregs are potent inhibitors of the immune system, suppressing T cells, B cells, natural killer (NK) cells, dendritic cells, and macrophages via humoral and cell-cell contact mechanisms. In the majority of solid tumors in the cervix, kidney, breast, and melanomas, the high frequency of tumor-infiltrating Tregs is often associated with poor prognosis.Citation34 Macrophages are polarized into two distinct phenotypes, the classically activated macrophages (M1-TAMs), which are pro-inflammatory, pro-immunity, and antitumor, or the alternative activated macrophages (M2-TAMs), which are anti-inflammatory, immune suppressive, and pro-tumor.Citation35 M2-TAMs promote tumor growth and metastases through a variety of diverse mechanisms, including facilitating angiogenesis, matrix breakdown, and tumor-cell motility.Citation36 Thus, we also focused our attention on the effects of different vaccination routes on systemic and tumor local immunosuppressive cells. We found decreased splenic MDSCs in subcutaneous and intratumoral group ( and H), as well as reduced splenic Tregs and M2-TAMs in all the three vaccinated groups (), while only intratumoral vaccination significantly reduced the frequency of tumor-infiltration MDSCs, Tregs, and M2-TAMs (). We hypothesized that the low frequency of tumor-infiltration MDSCs, Tregs and M2-TAMs in the intratumoral injection group might be associated with relieving immunosuppression and reinstating antitumor immune responses.

To better understand how intratumoral vaccination can significantly enhance the generation of tumor-infiltrating CD4+ and CD8+ T cells and the antitumor response, we assessed transcriptional changes of cytokines, chemokines, and MMPs in the tumor. IL-2 plays an important role in the development of adaptive immune response as it mediates the proliferation of T cells and differentiation into effector lymphocytes.Citation37 IL-12 is released by a variety of immune cells upon infection or inflammation to induce differentiation of Th1 cells and increase activity of CTLs as well as IFN-γ production.Citation38 Studies have indicated that TNF-α is frequently used in tumor immunotherapy while IFN-γ can directly inhibit tumor cell proliferation.Citation39 CXCL9 and CXCL10 promote the migration of effector T cells and NK cells into tumors.Citation40 Our experimental results demonstrated that compared with untreated controls, the three vaccination routes tested herein, increased the expression level of IL-2 (), IL-12 (), TNF-α (), IFN-γ (), CXCL9 (), and CXCL10 () in the tumor to varying degrees, but the intratumoral injection group showed the largest increase and the strongest effect. The increased numbers of tumor-infiltrating effector T cells in the intratumoral group might be associated with increased levels of antitumor cytokines as well as CXCL9 and CXCL10 chemokines. MDSCs,Citation41 Tregs,Citation42 and M2-TAMsCitation43 block T cell immune responses specific to tumor antigens via the production of immunosuppressive molecules including TGF-β, IL-10. TGF-β directly inhibits the stimulation, differentiation, proliferation, and effector function of CD4+ and CD8+ T cells that mediate immune responses.Citation44 IL-10, a known suppressive cytokine of T-cell proliferation and cytokine production, markedly reduces the function of effector T cells.Citation45 Studies have shown that the ablation of CXCL1 in tumor cells increased CD8+ T cell infiltration and induced responses to immunotherapy.Citation46 Our qRT-PCR results have shown that the intratumoral injection of the vaccine induced a significant decrease in IL-10 (), TGF-β () and CXCL1 () levels compared to those of control mice. We supposed that the significant increase of the pro-inflammatory and antitumor cytokines, and the decrease of these immunosuppressive cytokines in the intratumoral injection group can promote antitumor immunity and enhance the efficacy of immunotherapy.

HPV-related cancer such as cervical cancer is a spectrum disease with a gradual progression from pre-malignant condition to aggressive disease, which begins in the cervix, and later spreads towards the lower uterine segment, vagina, para-cervical space, along with the broad and uterosacral ligaments.Citation47 Among patients with cervical cancer, approximately 4.16%–7.7% develop lung metastasis, 0.8%–23% develop bone metastases, and the overall outcome of patients with metastatic cervical cancer is poor.Citation48 Thus, we evaluated indicators related to cervical cancer invasion and metastasis, including MMP-2, MMP-9, and α-SMA and their correlated expression with the different administration route of the vaccine. MMP-2 may enhance the invasive ability in cervical tumors by facilitating basement membrane and extracellular matrix degradation.Citation49 MMP-9 is an early marker of tumor progression in squamous lesions of the cervix, and MMP-9 mRNA expression is up-regulated in tumor and stromal cells of both high-grade cervical intraepithelial neoplasia and invasive squamous cell carcinoma of the cervix.Citation50 The level of MMP-2 and MMP-9 mRNA in the subcutaneous injection group was similar to those of a previous study, which was about 50% lower than that of the untreated control group.Citation7 The level of these MMPs mRNA in the intratumoral injection group was significantly reduced by approximately 90% compared to the control group (). Cancer-associated fibroblasts are major components of the surrounding stroma of cervical carcinomas, which may display an altered phenotype compared with normal fibroblasts characterized by increased expression of α-SMA and fibroblast activation protein.Citation51 The lowest expression of α-SMA in the intratumoral injection group was demonstrated in . Overall, our results showed marked downregulation of MMP-2, MMP-9, and α-SMA in the intratumoral vaccination group which might contribute to the suppression of tumor invasion and metastasis.

Angiogenesis plays an important role in high-grade cervical intraepithelial neoplasia and invasive squamous carcinoma of the cervix, as in other types of pre-malignant lesions and carcinoma;Citation52 thus, we detected markers of angiogenesis in tumors. A number of studies have shown that the HPV oncoprotein E6 might contribute to cervical cancer angiogenesis by direct stimulation of the VEGF gene, and the level of VEGF expression was associated with poor prognosis and early recurrence in cervical cancer.Citation53Citation55 In addition, cervical cancer angiogenesis measured by CD31 MVD is an independent prognostic factor for both progression-free survival and overall survival in high-risk, early-stage cervical cancer patients.Citation56 In this current study, we found that the reduced level of VEGF mRNA () and the decreased average MVD () in the tumor tissue of mice in the intratumoral injection group, which indicated that intratumoral injection of the vaccine could significantly inhibit the formation of tumor microvessels by regulating the expression and transcription levels of angiogenesis-related factors.

In the present study, we investigated the differences and mechanisms of antitumor effects induced by different vaccination routes, but the mechanisms underlying the different immune responses were not fully investigated and will be the focus of future studies. In our follow-up experiments, we will establish a multi-tumor model in mice to evaluate whether the intratumoral injection of the vaccine in a given tumor will also lead to the elimination of distant lesions. Further, we will deplete CD8+ T cells using neutralizing antibodies in mice to verify that CD8+ T cells are crucial to the antitumor effect induced by the vaccine.

Conclusion

We explored the anti-TC-1-grafted tumors activity induced by three different administration routes of an HPV therapeutic vaccine containing HPV 16 E7 43–77 peptide in combination with the toll-like receptor-9 agonist CpG ODN. Our results suggested that the intratumoral vaccination route generated an enhanced antitumor effect relative to subcutaneous vaccination route by improving the TME, and may have a significant impact on developing efficacious therapeutic vaccines for HPV-associated diseases including cervical cancer.

Abbreviations

HPV, human papillomavirus; CpG ODN, unmethylated cytosine-phosphate-guanosine oligodeoxynucleotide; MDSCs, myeloid-derived suppressor cells; Tregs, regulatory T cells; M2-TAMs, type 2-polarized tumor-associated macrophages; MMPs, matrix metalloproteinases; CTL, cytotoxic T lymphocyte; qRT-PCR, quantitative real-time reverse transcription polymerase chain reaction; CXCL, CXC-chemokine ligand; ANOVA, analysis of variance; MVD, microvessel density; NK, natural killer; Th1, T-helper type 1; SD, standard deviation; TILs, tumor-infiltrating lymphocytes; α-SMA, alpha-smooth muscle actin; VEGF, vascular endothelial growth factor; IL, interleukin; TNF-α, tumor necrosis factor alpha; TGF-β, transforming growth factor beta; IFN-γ, interferon gamma.

Disclosure

The authors report no conflicts of interest in this work.

References

  • CrosbieEJ, EinsteinMH, FranceschiS, KitchenerHC. Human papillomavirus and cervical cancer. Lancet. 2013;382(9895):889–899. doi:10.1016/S0140-6736(13)60022-723618600
  • MonieA, HungCF, RodenR, WuTC. Cervarix: a vaccine for the prevention of HPV 16, 18-associated cervical cancer. Biologics. 2008;2(1):97–105.
  • ClarkKT, TrimbleCL. Current status of therapeutic HPV vaccines. Gynecol Oncol. 2020;156(2):503–510. doi:10.1016/j.ygyno.2019.12.01731870557
  • Hoppe-SeylerK, BosslerF, BraunJA, HerrmannAL, Hoppe-SeylerF. The HPV E6/E7 oncogenes: key factors for viral carcinogenesis and therapeutic targets. Trends Microbiol. 2018;26(2):158–168. doi:10.1016/j.tim.2017.07.00728823569
  • NayerehKG, KhademG. Preventive and therapeutic vaccines against human papillomaviruses associated cervical cancers. Iran J Basic Med Sci. 2012;15(1):585–601.23493151
  • YangY, CheY, ZhaoY, WangX. Prevention and treatment of cervical cancer by a single administration of human papillomavirus peptide vaccine with CpG oligodeoxynucleotides as an adjuvant in vivo. Int Immunopharmacol. 2019;69:279–288. doi:10.1016/j.intimp.2019.01.02430743204
  • CheY, YangY, SuoJ, AnY, WangX. Induction of systemic immune responses and reversion of immunosuppression in the tumor microenvironment by a therapeutic vaccine for cervical cancer. Cancer Immunol Immunother. 2020;69(12):2651–2664. doi:10.1007/s00262-020-02651-332607768
  • HammerichL, BhardwajN, KohrtHE, BrodyJD. In situ vaccination for the treatment of cancer. Immunotherapy. 2016;8(3):315–330. doi:10.2217/imt.15.12026860335
  • Burn AschnerC, PierceC, KnipeDM, HeroldBC. Vaccination route as a determinant of protective antibody responses against herpes simplex virus. Vaccines. 2020;8:2.
  • MarabelleA, TselikasL, de BaereT, HouotR. Intratumoral immunotherapy: using the tumor as the remedy. Ann Oncol. 2017;28(suppl_12):xii33–xii43. doi:10.1093/annonc/mdx68329253115
  • NewmanJH, ChessonCB, HerzogNL, et al. Intratumoral injection of the seasonal flu shot converts immunologically cold tumors to hot and serves as an immunotherapy for cancer. Proc Natl Acad Sci U S A. 2020;117(2):1119–1128. doi:10.1073/pnas.190402211631888983
  • LeeJM, LeeMH, GaronE, et al. Phase I Trial of Intratumoral Injection of CCL21 gene-modified dendritic cells in lung cancer elicits tumor-specific immune responses and CD8(+) T-cell Infiltration. Clin Cancer Res. 2017;23(16):4556–4568. doi:10.1158/1078-0432.CCR-16-282128468947
  • UrsuR, CarpentierA, MetellusP, et al. Intracerebral injection of CpG oligonucleotide for patients with de novo glioblastoma-A Phase II multicentric, randomised study. Eur J Cancer. 2017;73:30–37. doi:10.1016/j.ejca.2016.12.00328142059
  • LeeSY, KangTH, KnoffJ, et al. Intratumoral injection of therapeutic HPV vaccinia vaccine following cisplatin enhances HPV-specific antitumor effects. Cancer Immunol Immunother. 2013;62(7):1175–1185. doi:10.1007/s00262-013-1421-y23615841
  • NicholsAJ, GonzalezA, ClarkES, et al. Combined systemic and intratumoral administration of human papillomavirus vaccine to treat multiple cutaneous basaloid squamous cell carcinomas. JAMA Dermatol. 2018;154(8):927–930. doi:10.1001/jamadermatol.2018.174829971321
  • IshidaE, LeeJ, CampbellJS, et al. Intratumoral delivery of an HPV vaccine elicits a broad anti-tumor immune response that translates into a potent anti-tumor effect in a preclinical murine HPV model. Cancer Immunol Immunother. 2019;68(8):1273–1286. doi:10.1007/s00262-019-02357-131243491
  • PengS, TanM, LiYD, et al. PD-1 blockade synergizes with intratumoral vaccination of a therapeutic HPV protein vaccine and elicits regression of tumor in a preclinical model. Cancer Immunol Immunother. 2020;70:1049.33108473
  • YangMC, YangA, QiuJ, et al. Buccal injection of synthetic HPV long peptide vaccine induces local and systemic antigen-specific CD8+ T-cell immune responses and antitumor effects without adjuvant. Cell Biosci. 2016;6:17. doi:10.1186/s13578-016-0083-926949512
  • KawaradaY, GanssR, GarbiN, SacherT, ArnoldB, HammerlingGJ. NK- and CD8(+) T cell-mediated eradication of established tumors by peritumoral injection of CpG-containing oligodeoxynucleotides. J Immunol. 2001;167(9):5247–5253. doi:10.4049/jimmunol.167.9.524711673539
  • OnoT, HaradaM, YamadaA, et al. Antitumor effects of systemic and local immunization with a CTL-directed peptide in combination with a local injection of OK-432. Clin Cancer Res. 2006;12(4):1325–1332. doi:10.1158/1078-0432.CCR-05-129316489090
  • BriantiP, De FlammineisE, MercuriSR. Review of HPV-related diseases and cancers. New Microbiol. 2017;40(2):80–85.28368072
  • RomagnaniS. T-cell subsets (Th1 versus Th2). Ann Allergy Asthma Immunol. 2000;85(1):9–18. doi:10.1016/S1081-1206(10)62426-X10923599
  • BosR, ShermanLA. CD4+ T-cell help in the tumor milieu is required for recruitment and cytolytic function of CD8+ T lymphocytes. Cancer Res. 2010;70(21):8368–8377. doi:10.1158/0008-5472.CAN-10-132220940398
  • MarzoAL, KinnearBF, LakeRA, et al. Tumor-specific CD4+ T cells have a major “post-licensing” role in CTL mediated anti-tumor immunity. J Immunol. 2000;165(11):6047–6055. doi:10.4049/jimmunol.165.11.604711086036
  • WongSB, BosR, ShermanLA. Tumor-specific CD4+ T cells render the tumor environment permissive for infiltration by low-avidity CD8+ T cells. J Immunol. 2008;180(5):3122–3131. doi:10.4049/jimmunol.180.5.312218292535
  • MesafintZ, BerhaneY, DesalegnD. Health seeking behavior of patients diagnosed with cervical cancer in Addis Ababa, Ethiopia. Ethiop J Health Sci. 2018;28(2):111–116. doi:10.4314/ejhs.v28i2.229983508
  • MwakaAD, OkelloES, WabingaH, WalterFM. Symptomatic presentation with cervical cancer in Uganda: a qualitative study assessing the pathways to diagnosis in a low-income country. BMC Womens Health. 2015;15(1):15. doi:10.1186/s12905-015-0167-425783641
  • ButterfieldLH. Cancer vaccines. BMJ. 2015;350:h988. doi:10.1136/bmj.h98825904595
  • RomaniN, ThurnherM, IdoyagaJ, SteinmanRM, FlacherV. Targeting of antigens to skin dendritic cells: possibilities to enhance vaccine efficacy. Immunol Cell Biol. 2010;88(4):424–430. doi:10.1038/icb.2010.3920368713
  • NicolasJF, GuyB. Intradermal, epidermal and transcutaneous vaccination: from immunology to clinical practice. Expert Rev Vaccines. 2008;7(8):1201–1214. doi:10.1586/14760584.7.8.120118844594
  • HamidO, IsmailR, PuzanovI. Intratumoral Immunotherapy-Update 2019. Oncologist. 2020;25(3):e423–e438. doi:10.1634/theoncologist.2019-043832162802
  • KalathilSG, ThanavalaY. High immunosuppressive burden in cancer patients: a major hurdle for cancer immunotherapy. Cancer Immunol Immunother. 2016;65(7):813–819. doi:10.1007/s00262-016-1810-026910314
  • SicaA, MassarottiM. Myeloid suppressor cells in cancer and autoimmunity. J Autoimmun. 2017;85:117–125. doi:10.1016/j.jaut.2017.07.01028728794
  • TanakaA, SakaguchiS. Regulatory T cells in cancer immunotherapy. Cell Res. 2017;27(1):109–118. doi:10.1038/cr.2016.15127995907
  • BrownJM, RechtL, StroberS. The Promise of Targeting Macrophages in Cancer Therapy. Clin Cancer Res. 2017;23(13):3241–3250. doi:10.1158/1078-0432.CCR-16-312228341752
  • PollardJW. Tumour-educated macrophages promote tumour progression and metastasis. Nat Rev Cancer. 2004;4(1):71–78. doi:10.1038/nrc125614708027
  • SpolskiR, LiP, LeonardWJ. Biology and regulation of IL-2: from molecular mechanisms to human therapy. Nat Rev Immunol. 2018;18(10):648–659. doi:10.1038/s41577-018-0046-y30089912
  • ZundlerS, NeurathMF. Interleukin-12: functional activities and implications for disease. Cytokine Growth Factor Rev. 2015;26(5):559–568. doi:10.1016/j.cytogfr.2015.07.00326182974
  • KearneyCJ, VervoortSJ, HoggSJ, et al. Tumor immune evasion arises through loss of TNF sensitivity. Sci Immunol. 2018;3:23. doi:10.1126/sciimmunol.aar3451
  • NagarshethN, WichaMS, ZouW. Chemokines in the cancer microenvironment and their relevance in cancer immunotherapy. Nat Rev Immunol. 2017;17(9):559–572. doi:10.1038/nri.2017.4928555670
  • MarvelD, GabrilovichDI. Myeloid-derived suppressor cells in the tumor microenvironment: expect the unexpected. J Clin Invest. 2015;125(9):3356–3364. doi:10.1172/JCI8000526168215
  • SchmidtA, OberleN, KrammerPH. Molecular mechanisms of treg-mediated T cell suppression. Front Immunol. 2012;3:51. doi:10.3389/fimmu.2012.0005122566933
  • Sawa-WejkszaK, Kandefer-SzerszenM. Tumor-associated macrophages as target for antitumor therapy. Arch Immunol Ther Exp (Warsz). 2018;66(2):97–111. doi:10.1007/s00005-017-0480-828660349
  • ShengJ, ChenW, ZhuHJ. The immune suppressive function of transforming growth factor-beta (TGF-beta) in human diseases. Growth Factors. 2015;33(2):92–101. doi:10.3109/08977194.2015.101064525714613
  • TaylorA, VerhagenJ, BlaserK, AkdisM, AkdisCA. Mechanisms of immune suppression by interleukin-10 and transforming growth factor-beta: the role of T regulatory cells. Immunology. 2006;117(4):433–442. doi:10.1111/j.1365-2567.2006.02321.x16556256
  • LiJ, ByrneKT, YanF, et al. Tumor cell-intrinsic factors underlie heterogeneity of immune cell infiltration and response to immunotherapy. Immunity. 2018;49(1):178–193 e177. doi:10.1016/j.immuni.2018.06.00629958801
  • HassanRN, LuoH, JiangW. Effects of nicotinamide on cervical cancer-derived fibroblasts: evidence for therapeutic potential. Cancer Manag Res. 2020;12:1089–1100. doi:10.2147/CMAR.S22939532104089
  • LiH, WuX, ChengX. Advances in diagnosis and treatment of metastatic cervical cancer. J Gynecol Oncol. 2016;27(4):e43. doi:10.3802/jgo.2016.27.e4327171673
  • DavidsonB, GoldbergI, KopolovicJ, et al. MMP-2 and TIMP-2 expression correlates with poor prognosis in cervical carcinoma–a clinicopathologic study using immunohistochemistry and mRNA in situ hybridization. Gynecol Oncol. 1999;73(3):372–382. doi:10.1006/gyno.1999.538110366463
  • DavidsonB, GoldbergI, KopolovicJ, et al. Expression of matrix metalloproteinase-9 in squamous cell carcinoma of the uterine cervix-clinicopathologic study using immunohistochemistry and mRNA in situ hybridization. Gynecol Oncol. 1999;72(3):380–386. doi:10.1006/gyno.1998.528510053110
  • ErdoganB, WebbDJ. Cancer-associated fibroblasts modulate growth factor signaling and extracellular matrix remodeling to regulate tumor metastasis. Biochem Soc Trans. 2017;45(1):229–236. doi:10.1042/BST2016038728202677
  • TomaoF, PapaA, RossiL, et al. Angiogenesis and antiangiogenic agents in cervical cancer. Onco Targets Ther. 2014;7:2237–2248. doi:10.2147/OTT.S6828625506227
  • Lopez-OcejoO, Viloria-PetitA, Bequet-RomeroM, MukhopadhyayD, RakJ, KerbelRS. Oncogenes and tumor angiogenesis: the HPV-16 E6 oncoprotein activates the vascular endothelial growth factor (VEGF) gene promoter in a p53 independent manner. Oncogene. 2000;19(40):4611–4620. doi:10.1038/sj.onc.120381711030150
  • FujimotoJ, ToyokiH, SatoE, SakaguchiH, TamayaT. Clinical implication of expression of vascular endothelial growth factor-C in metastatic lymph nodes of uterine cervical cancers. Br J Cancer. 2004;91(3):466–469. doi:10.1038/sj.bjc.660196315226772
  • ChoiCH, SongSY, ChoiJJ, et al. Prognostic significance of VEGF expression in patients with bulky cervical carcinoma undergoing neoadjuvant chemotherapy. BMC Cancer. 2008;8:295. doi:10.1186/1471-2407-8-29518847499
  • RandallLM, MonkBJ, DarcyKM, et al. Markers of angiogenesis in high-risk, early-stage cervical cancer: a Gynecologic Oncology Group study. Gynecol Oncol. 2009;112(3):583–589. doi:10.1016/j.ygyno.2008.11.01319110305