References
- Berglund L, Brunzell JD, Goldberg AC, et al., Endocrine society. Evaluation and treatment of hypertriglyceridemia: an Endocrine Society clinical practice guideline. J Clin Endocrinol Metab. 2012;97:2969–2989.
- Jessen RH, Dass CJ, Eckfeldt JH. Do enzymatic analyses of serum triglycerides really need blanking for free glycerol? Clin Chem. 1990;36:1372–1375.
- Dipple KM, Zhang YH, Huang BL, et al. Glycerol kinase deficiency: evidence for complexity in a single gene disorder. Hum Genet. 2001;109:55–62.
- Sjarif DR, Ploos van Amstel JK, Duran M, et al. Isolated and contiguous glycerol kinase gene disorders: a review. J Inherit Metab Dis. 2000;23:529–547.
- Backes JM, Dayspring T, Mieras T, et al. Pseudohypertriglyceridemia: two cases of probable glycerol kinase deficiency. J Clin Lipidol. 2012;6:469–473.
- Gaudet D, Arsenault S, Perusse L, et al. Glycerol as a correlate of impaired glucose tolerance: dissection of a complex system by use of a simple genetic trait. Am J Hum Genet. 2000;66:1558–1568.
- Fodor E, Hellerud C, Hulting J, et al. Glycerol kinase deficiency in adult hypoglycemic acidemia. N Engl J Med. 2011;364:1781–1782.
- Hellerud C, Adamowicz M, Jurkiewicz D, et al. Clinical heterogeneity and molecular findings in five Polish patients with glycerol kinase deficiency: investigation of two splice site mutations with computerized splice junction analysis and Xp21 gene-specific mRNA analysis. Mol Genet Metab. 2003;79:149–159.
- Hellerud C, Burlina A, Gabelli C, et al. Glycerol metabolism and the determination of triglycerides-clinical, biochemical and molecular findings in six subjects. Clin Chem Lab Med. 2003;41:46–55.
- Illsinger S, Marquardt I, Lucke T, et al. Two cases of isolated glycerol kinase deficiency with heterogeneous neurological symptoms. Dev Med Child Neurol. 2007;49:396–397.
- Nordenstrom A, Hellerud C, Lindstedt S, et al. Acute liver failure in a child with Epstein-Barr virus infection and undiagnosed glycerol kinase deficiency, mimicking hemophagocytic lymphohistiocytosis. J Pediatr Gastroenterol Nutr. 2008;47:98–101.
- Zhang YH, Van Hove JL, McCabe ER, et al. Gestational diabetes associated with a novel mutation (378-379insTT) in the glycerol kinase gene. Mol Genet Metab Rep. 2015;4:42–45.
- Backes JM, Dayspring T, Moriarty PM. Pseudohypertriglyceridemia-verifying the hypertriglyceridemic patient. J Clin Lipidol. 2013;7:182–183.
- Hegele RA, Ginsberg HN, Chapman MJ, et al., European Atherosclerosis Society Consensus Panel. The polygenic nature of hypertriglyceridaemia: implications for definition, diagnosis, and management. Lancet Diabetes Endocrinol. 2014;2:655–666.
- Stinshoff K, Weisshaar D, Staehler F, et al. Relation between concentrations of free glycerol and triglycerides in human sera. Clin Chem. 1977;23:1029–1032.
- Arner P, Ryden M. Fatty acids, obesity and insulin resistance. Obes Facts. 2015;8:147–155.
- Brisson D, Methot J, Tremblay K, et al. Comparison of the efficacy of fibrates on hypertriglyceridemic phenotypes with different genetic and clinical characteristics. Pharmacogenet Genomics. 2010;20:742–747.
- Bolinder J, Kerckhoffs DA, Moberg E, et al. Rates of skeletal muscle and adipose tissue glycerol release in nonobese and obese subjects. Diabetes. 2000;49:797–802.
- Jansson PA, Larsson A, Smith U, et al. Glycerol production in subcutaneous adipose tissue in lean and obese humans. J Clin Invest. 1992;89:1610–1617.